Recombinant Full Length Human MOBKL3 Protein, GST-tagged
| Cat.No. : | MOBKL3-6296HF |
| Product Overview : | Human MOBKL3 full-length ORF ( NP_056202.2, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 225 amino acids |
| Description : | This gene was identified based on its similarity with the mouse counterpart. Studies of the mouse counterpart suggest that the expression of this gene may be regulated during oocyte maturation and preimplantation following zygotic gene activation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq |
| Molecular Mass : | 52.4 kDa |
| AA Sequence : | MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MOB4 MOB family member 4, phocein [ Homo sapiens (human) ] |
| Official Symbol | MOBKL3 |
| Synonyms | MOB4; MOB family member 4, phocein; 2C4D; MOB1; MOB3; PHOCN; PREI3; CGI-95; MOBKL3; MOB-like protein phocein; MOB1, Mps One Binder kinase activator-like 3; Mps One Binder kinase activator- like 3; class II mMOB1; mob1 homolog 3; phocein, Mob-like protein; preimplantation protein 3 |
| Gene ID | 25843 |
| mRNA Refseq | NM_001100819 |
| Protein Refseq | NP_001094289 |
| MIM | 609361 |
| UniProt ID | Q9Y3A3 |
| ◆ Recombinant Proteins | ||
| MOBKL3-3400H | Recombinant Human MOBKL3 protein, His-tagged | +Inquiry |
| MOBKL3-5460H | Recombinant Human MOBKL3 Protein, GST-tagged | +Inquiry |
| MOBKL3-2802R | Recombinant Rhesus monkey MOBKL3 Protein, His-tagged | +Inquiry |
| MOBKL3-2622R | Recombinant Rhesus Macaque MOBKL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MOBKL3-6296HF | Recombinant Full Length Human MOBKL3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOBKL3 Products
Required fields are marked with *
My Review for All MOBKL3 Products
Required fields are marked with *
