Recombinant Human MOBKL3 Protein, GST-tagged

Cat.No. : MOBKL3-5460H
Product Overview : Human MOBKL3 full-length ORF ( NP_056202.2, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene was identified based on its similarity with the mouse counterpart. Studies of the mouse counterpart suggest that the expression of this gene may be regulated during oocyte maturation and preimplantation following zygotic gene activation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
Molecular Mass : 52.4 kDa
AA Sequence : MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MOB4 MOB family member 4, phocein [ Homo sapiens (human) ]
Official Symbol MOBKL3
Synonyms MOB4; MOB family member 4, phocein; 2C4D; MOB1; MOB3; PHOCN; PREI3; CGI-95; MOBKL3; MOB-like protein phocein; MOB1, Mps One Binder kinase activator-like 3; Mps One Binder kinase activator- like 3; class II mMOB1; mob1 homolog 3; phocein, Mob-like protein; preimplantation protein 3
Gene ID 25843
mRNA Refseq NM_001100819
Protein Refseq NP_001094289
MIM 609361
UniProt ID Q9Y3A3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOBKL3 Products

Required fields are marked with *

My Review for All MOBKL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon