Recombinant Full Length Human MOCS3 Protein, GST-tagged
Cat.No. : | MOCS3-6301HF |
Product Overview : | Human MOCS3 full-length ORF ( AAH15939, 1 a.a. - 460 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 460 amino acids |
Description : | Molybdenum cofactor (MoCo) is necessary for the function of all molybdoenzymes. One of the enzymes required for the biosynthesis of MoCo is molybdopterin synthase (MPT synthase). The protein encoded by this gene adenylates and activates MPT synthase. This gene contains no introns. A pseudogene of this gene is present on chromosome 14. [provided by RefSeq |
Molecular Mass : | 76.34 kDa |
AA Sequence : | MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MOCS3 molybdenum cofactor synthesis 3 [ Homo sapiens ] |
Official Symbol | MOCS3 |
Synonyms | MOCS3; molybdenum cofactor synthesis 3; adenylyltransferase and sulfurtransferase MOCS3; dJ914P20.3; UBA4; ubiquitin activating enzyme E1 homolog (yeast); ubiquitin like modifier activating enzyme 4; MPT synthase sulfurylase; molybdopterin synthase sulfurylase; molybdenum cofactor synthesis protein 3; ubiquitin-like modifier activating enzyme 4; UBA4, ubiquitin-activating enzyme E1 homolog; MGC9252; |
Gene ID | 27304 |
mRNA Refseq | NM_014484 |
Protein Refseq | NP_055299 |
MIM | 609277 |
UniProt ID | O95396 |
◆ Recombinant Proteins | ||
MOCS3-5624M | Recombinant Mouse MOCS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Mocs3-3194M | Recombinant Mouse Mocs3, His-tagged | +Inquiry |
MOCS3-6301HF | Recombinant Full Length Human MOCS3 Protein, GST-tagged | +Inquiry |
MOCS3-585H | Recombinant Human MOCS3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MOCS3-9950M | Recombinant Mouse MOCS3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOCS3-4259HCL | Recombinant Human MOCS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOCS3 Products
Required fields are marked with *
My Review for All MOCS3 Products
Required fields are marked with *
0
Inquiry Basket