Recombinant Full Length Human MOCS3 Protein, GST-tagged

Cat.No. : MOCS3-6301HF
Product Overview : Human MOCS3 full-length ORF ( AAH15939, 1 a.a. - 460 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 460 amino acids
Description : Molybdenum cofactor (MoCo) is necessary for the function of all molybdoenzymes. One of the enzymes required for the biosynthesis of MoCo is molybdopterin synthase (MPT synthase). The protein encoded by this gene adenylates and activates MPT synthase. This gene contains no introns. A pseudogene of this gene is present on chromosome 14. [provided by RefSeq
Molecular Mass : 76.34 kDa
AA Sequence : MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MOCS3 molybdenum cofactor synthesis 3 [ Homo sapiens ]
Official Symbol MOCS3
Synonyms MOCS3; molybdenum cofactor synthesis 3; adenylyltransferase and sulfurtransferase MOCS3; dJ914P20.3; UBA4; ubiquitin activating enzyme E1 homolog (yeast); ubiquitin like modifier activating enzyme 4; MPT synthase sulfurylase; molybdopterin synthase sulfurylase; molybdenum cofactor synthesis protein 3; ubiquitin-like modifier activating enzyme 4; UBA4, ubiquitin-activating enzyme E1 homolog; MGC9252;
Gene ID 27304
mRNA Refseq NM_014484
Protein Refseq NP_055299
MIM 609277
UniProt ID O95396

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOCS3 Products

Required fields are marked with *

My Review for All MOCS3 Products

Required fields are marked with *

0
cart-icon
0
compare icon