Recombinant Full Length Human MORF4 Protein, GST-tagged

Cat.No. : MORF4-6308HF
Product Overview : Human MORF4 full-length ORF ( NP_006783.2, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 235 amino acids
Description : Cellular senescence, the terminal nondividing state that normal cells enter following completion of their proliferative potential, is the dominant phenotype in hybrids of normal and immortal cells. Fusions of immortal human cell lines with each other have led to their assignment to 1 of several complementation groups. MORF4 is a gene on chromosome 4 that induces a senescent-like phenotype in cell lines assigned to complementation group B.[supplied by OMIM
Molecular Mass : 53.1 kDa
AA Sequence : MRWAAPGKKTSGLQQKNIEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRAQVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAEKNVDSILEDYANYKKSHGNTDNKEYAVNEVVAGIKEYFNLMLGTQLLNKFERPQYAEILADCPDAPMSQVYGVPHLLRLSVQIGAMLAYTPLNEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVALPEYHRKAV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MORF4 mortality factor 4 (pseudogene) [ Homo sapiens (human) ]
Official Symbol MORF4
Synonyms MORF4; mortality factor 4 (pseudogene); CSR; SEN; CSRB; SEN1; mortality factor 4 like 1 pseudogene; senescence (cellular)-related 1; senescence-related, cellular, 1
Gene ID 10934

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MORF4 Products

Required fields are marked with *

My Review for All MORF4 Products

Required fields are marked with *

0
cart-icon