Recombinant Human MORF4 Protein, GST-tagged
Cat.No. : | MORF4-5476H |
Product Overview : | Human MORF4 full-length ORF ( NP_006783.2, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Cellular senescence, the terminal nondividing state that normal cells enter following completion of their proliferative potential, is the dominant phenotype in hybrids of normal and immortal cells. Fusions of immortal human cell lines with each other have led to their assignment to 1 of several complementation groups. MORF4 is a gene on chromosome 4 that induces a senescent-like phenotype in cell lines assigned to complementation group B.[supplied by OMIM |
Molecular Mass : | 53.1 kDa |
AA Sequence : | MRWAAPGKKTSGLQQKNIEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRAQVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAEKNVDSILEDYANYKKSHGNTDNKEYAVNEVVAGIKEYFNLMLGTQLLNKFERPQYAEILADCPDAPMSQVYGVPHLLRLSVQIGAMLAYTPLNEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVALPEYHRKAV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MORF4 mortality factor 4 (pseudogene) [ Homo sapiens (human) ] |
Official Symbol | MORF4 |
Synonyms | MORF4; mortality factor 4 (pseudogene); CSR; SEN; CSRB; SEN1; mortality factor 4 like 1 pseudogene; senescence (cellular)-related 1; senescence-related, cellular, 1 |
Gene ID | 10934 |
MIM | 116960 |
◆ Recombinant Proteins | ||
MORF4-6308HF | Recombinant Full Length Human MORF4 Protein, GST-tagged | +Inquiry |
MORF4-2999H | Recombinant Human Mortality Factor 4, T7-tagged | +Inquiry |
MORF4-5476H | Recombinant Human MORF4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MORF4-4253HCL | Recombinant Human MORF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MORF4 Products
Required fields are marked with *
My Review for All MORF4 Products
Required fields are marked with *