Recombinant Full Length Human MPLKIP Protein, GST-tagged

Cat.No. : MPLKIP-3849HF
Product Overview : Human C7orf11 full-length ORF ( NP_619646.1, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 179 amino acids
Description : The protein encoded by this gene localizes to the centrosome during mitosis and to the midbody during cytokinesis. The protein is phosphorylated by cyclin-dependent kinase 1 during mitosis and subsequently interacts with polo-like kinase 1. The protein is thought to function in regulating mitosis and cytokinesis. Mutations in this gene result in nonphotosensitive trichothiodystrophy. [provided by RefSeq, Nov 2009]
Molecular Mass : 45.5 kDa
AA Sequence : MQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRPYGSSHSPRHGGSFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MPLKIP M-phase specific PLK1 interacting protein [ Homo sapiens (human) ]
Official Symbol MPLKIP
Synonyms C7orf11; MPLKIP; M-phase specific PLK1 interacting protein; M-phase-specific PLK1-interacting protein; Russell-Silver syndrome region; TTD non-photosensitive 1 protein
Gene ID 136647
mRNA Refseq NM_138701
Protein Refseq NP_619646
MIM 609188
UniProt ID Q8TAP9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MPLKIP Products

Required fields are marked with *

My Review for All MPLKIP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon