Recombinant Human MPLKIP Protein, GST-tagged
Cat.No. : | MPLKIP-5218H |
Product Overview : | Human C7orf11 full-length ORF ( NP_619646.1, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene localizes to the centrosome during mitosis and to the midbody during cytokinesis. The protein is phosphorylated by cyclin-dependent kinase 1 during mitosis and subsequently interacts with polo-like kinase 1. The protein is thought to function in regulating mitosis and cytokinesis. Mutations in this gene result in nonphotosensitive trichothiodystrophy. [provided by RefSeq, Nov 2009] |
Molecular Mass : | 45.5 kDa |
AA Sequence : | MQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRPYGSSHSPRHGGSFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MPLKIP M-phase specific PLK1 interacting protein [ Homo sapiens (human) ] |
Official Symbol | MPLKIP |
Synonyms | C7orf11; MPLKIP; M-phase specific PLK1 interacting protein; M-phase-specific PLK1-interacting protein; Russell-Silver syndrome region; TTD non-photosensitive 1 protein |
Gene ID | 136647 |
mRNA Refseq | NM_138701 |
Protein Refseq | NP_619646 |
MIM | 609188 |
UniProt ID | Q8TAP9 |
◆ Recombinant Proteins | ||
MPLKIP-3849HF | Recombinant Full Length Human MPLKIP Protein, GST-tagged | +Inquiry |
MPLKIP-5218H | Recombinant Human MPLKIP Protein, GST-tagged | +Inquiry |
MPLKIP-7987Z | Recombinant Zebrafish MPLKIP | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPLKIP-7975HCL | Recombinant Human C7orf11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPLKIP Products
Required fields are marked with *
My Review for All MPLKIP Products
Required fields are marked with *