Recombinant Full Length Human MPO Protein, C-Flag-tagged
Cat.No. : | MPO-1300HFL |
Product Overview : | Recombinant Full Length Human MPO Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heavy chain. The mature myeloperoxidase is a tetramer composed of 2 light chains and 2 heavy chains. This enzyme produces hypohalous acids central to the microbicidal activity of neutrophils. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 83.7 kDa |
AA Sequence : | MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTSLVLSSMEEAK QLVDKAYKERRESIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLHVALDLLERKLRSLWRRPFNV TDVLTPAQLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLP YGWTPGVKRNGFPVALARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVN CETSCVQQPPCFPLKIPPNDPRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLA RNLRNMSNQLGLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLL REHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRI ANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQ NQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKL MEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLP RIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREASTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | MPO myeloperoxidase [ Homo sapiens (human) ] |
Official Symbol | MPO |
Synonyms | Myeloperoxidase |
Gene ID | 4353 |
mRNA Refseq | NM_000250.2 |
Protein Refseq | NP_000241.1 |
MIM | 606989 |
UniProt ID | P05164 |
◆ Recombinant Proteins | ||
Mpo-2639R | Recombinant Rat Mpo protein, His & T7-tagged | +Inquiry |
MPO-5506H | Recombinant Human MPO Protein, GST-tagged | +Inquiry |
Mpo-52M | Recombinant Mouse Mpo Protein, His-tagged | +Inquiry |
MPO-4004H | Recombinant Human MPO Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MPO-1300HFL | Recombinant Full Length Human MPO Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
MPO-8220H | Native Human Neutrophil Myeloperoxidase | +Inquiry |
MPO-01H | Active Native Human MPO Protein | +Inquiry |
MPO -27H | Active Native Human Myeloperoxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPO-4234HCL | Recombinant Human MPO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPO Products
Required fields are marked with *
My Review for All MPO Products
Required fields are marked with *
0
Inquiry Basket