Recombinant Full Length Human MPZL2 Protein, GST-tagged
Cat.No. : | MPZL2-6339HF |
Product Overview : | Human MPZL2 full-length ORF ( NP_005788.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 215 amino acids |
Description : | Thymus development depends on a complex series of interactions between thymocytes and the stromal component of the organ. Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. This gene is expressed in the thymus and in several epithelial structures early in embryogenesis. It is highly homologous to the myelin protein zero and, in thymus-derived epithelial cell lines, is poorly soluble in nonionic detergents, strongly suggesting an association to the cytoskeleton. Its capacity to mediate cell adhesion through a homophilic interaction and its selective regulation by T cell maturation might imply the participation of EVA in the earliest phases of thymus organogenesis. The protein bears a characteristic V-type domain and two potential N-glycosylation sites in the extracellular domain; a putative serine phosphorylation site for casein kinase 2 is also present in the cytoplasmic tail. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq |
Molecular Mass : | 50.9 kDa |
AA Sequence : | MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRKKRWAERAHKVVEIKSKEEERLNQEKKVSVYLEDTD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MPZL2 myelin protein zero-like 2 [ Homo sapiens ] |
Official Symbol | MPZL2 |
Synonyms | MPZL2; myelin protein zero-like 2; epithelial V like antigen 1 , EVA1; myelin protein zero-like protein 2; EVA; epithelial V-like antigen 1; EVA1; |
Gene ID | 10205 |
mRNA Refseq | NM_005797 |
Protein Refseq | NP_005788 |
MIM | 604873 |
UniProt ID | O60487 |
◆ Recombinant Proteins | ||
MPZL2-6339HF | Recombinant Full Length Human MPZL2 Protein, GST-tagged | +Inquiry |
MPZL2-5526H | Recombinant Human MPZL2 Protein, GST-tagged | +Inquiry |
MPZL2-1593M | Recombinant Mouse MPZL2 protein, hFc-tagged | +Inquiry |
RFL4191HF | Recombinant Full Length Human Myelin Protein Zero-Like Protein 2(Mpzl2) Protein, His-Tagged | +Inquiry |
MPZL2-3214H | Recombinant Human MPZL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPZL2-4217HCL | Recombinant Human MPZL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPZL2 Products
Required fields are marked with *
My Review for All MPZL2 Products
Required fields are marked with *