Recombinant Full Length Human MRGPRF Protein, GST-tagged

Cat.No. : MRGPRF-6360HF
Product Overview : Human MRGPRF full-length ORF ( AAH16964, 1 a.a. - 343 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 343 amino acids
Description : MRGPRF (MAS Related GPR Family Member F) is a Protein Coding gene. GO annotations related to this gene include G-protein coupled receptor activity. An important paralog of this gene is MRGPRD.
Molecular Mass : 63.47 kDa
AA Sequence : MAGNCSWEAHPGNRNKMCPGLSEAPELYSRGFLTIEQIAMLPPPAVMNYIFLLLCLCGLVGNGLVLWFFGFSIKRNPFSIYFLHLASADVGYLFSKAVFSILNTGGFLGTFADYIRSVCRVLGLCMFLTGVSLLPAVSAERCASVIFPAWYWRRRPKRLSAVVCALLWVLSLLVTCLHNYFCVFLGRGAPGAACRHMDIFLGILLFLLCCPLMVLPCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCICINSSAKPIVYFLAGRDKSQRLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MRGPRF MAS-related GPR, member F [ Homo sapiens ]
Official Symbol MRGPRF
Synonyms MRGPRF; MAS-related GPR, member F; G protein coupled receptor 140 , G protein coupled receptor 168 , GPR140, GPR168; mas-related G-protein coupled receptor member F; MGC21621; mrgF; mas-related gene F protein; G protein-coupled receptor 140; G protein-coupled receptor 168; G-protein coupled receptor 140; G-protein coupled receptor 168; G protein-coupled receptor MrgF; mas-related G protein-coupled MRGF; seven transmembrane helix receptor; RTA; MRGF; GPR140; GPR168; FLJ16111; FLJ29034; FLJ40998; FLJ53714; DKFZp586B2122;
Gene ID 116535
mRNA Refseq NM_001098515
Protein Refseq NP_001091985
MIM 607233
UniProt ID Q96AM1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRGPRF Products

Required fields are marked with *

My Review for All MRGPRF Products

Required fields are marked with *

0
cart-icon
0
compare icon