Recombinant Full Length Human MRGPRF Protein, GST-tagged
| Cat.No. : | MRGPRF-6360HF |
| Product Overview : | Human MRGPRF full-length ORF ( AAH16964, 1 a.a. - 343 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 343 amino acids |
| Description : | MRGPRF (MAS Related GPR Family Member F) is a Protein Coding gene. GO annotations related to this gene include G-protein coupled receptor activity. An important paralog of this gene is MRGPRD. |
| Molecular Mass : | 63.47 kDa |
| AA Sequence : | MAGNCSWEAHPGNRNKMCPGLSEAPELYSRGFLTIEQIAMLPPPAVMNYIFLLLCLCGLVGNGLVLWFFGFSIKRNPFSIYFLHLASADVGYLFSKAVFSILNTGGFLGTFADYIRSVCRVLGLCMFLTGVSLLPAVSAERCASVIFPAWYWRRRPKRLSAVVCALLWVLSLLVTCLHNYFCVFLGRGAPGAACRHMDIFLGILLFLLCCPLMVLPCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCICINSSAKPIVYFLAGRDKSQRLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MRGPRF MAS-related GPR, member F [ Homo sapiens ] |
| Official Symbol | MRGPRF |
| Synonyms | MRGPRF; MAS-related GPR, member F; G protein coupled receptor 140 , G protein coupled receptor 168 , GPR140, GPR168; mas-related G-protein coupled receptor member F; MGC21621; mrgF; mas-related gene F protein; G protein-coupled receptor 140; G protein-coupled receptor 168; G-protein coupled receptor 140; G-protein coupled receptor 168; G protein-coupled receptor MrgF; mas-related G protein-coupled MRGF; seven transmembrane helix receptor; RTA; MRGF; GPR140; GPR168; FLJ16111; FLJ29034; FLJ40998; FLJ53714; DKFZp586B2122; |
| Gene ID | 116535 |
| mRNA Refseq | NM_001098515 |
| Protein Refseq | NP_001091985 |
| MIM | 607233 |
| UniProt ID | Q96AM1 |
| ◆ Recombinant Proteins | ||
| MRGPRF-5677M | Recombinant Mouse MRGPRF Protein, His (Fc)-Avi-tagged | +Inquiry |
| MRGPRF-10033M | Recombinant Mouse MRGPRF Protein | +Inquiry |
| RFL18121RF | Recombinant Full Length Rat Mas-Related G-Protein Coupled Receptor Member F(Mrgprf) Protein, His-Tagged | +Inquiry |
| MRGPRF-3415R | Recombinant Rat MRGPRF Protein, His (Fc)-Avi-tagged | +Inquiry |
| MRGPRF-6360HF | Recombinant Full Length Human MRGPRF Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MRGPRF-4205HCL | Recombinant Human MRGPRF 293 Cell Lysate | +Inquiry |
| MRGPRF-1091HCL | Recombinant Human MRGPRF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRGPRF Products
Required fields are marked with *
My Review for All MRGPRF Products
Required fields are marked with *
