Recombinant Full Length Rat Mas-Related G-Protein Coupled Receptor Member F(Mrgprf) Protein, His-Tagged
| Cat.No. : | RFL18121RF |
| Product Overview : | Recombinant Full Length Rat Mas-related G-protein coupled receptor member F(Mrgprf) Protein (P23749) (1-343aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-343) |
| Form : | Lyophilized powder |
| AA Sequence : | MAGNCSWEAHSTNQNKMCPGMSEALELYSRGFLTIEQIATLPPPAVTNYIFLLLCLCGLV GNGLVLWFFGFSIKRTPFSIYFLHLASADGIYLFSKAVIALLNMGTFLGSFPDYVRRVSR IVGLCTFFAGVSLLPAISIERCVSVIFPMWYWRRRPKRLSAGVCALLWLLSFLVTSIHNY FCMFLGHEASGTACLNMDISLGILLFFLFCPLMVLPCLALILHVECRARRRQRSAKLNHV VLAIVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCICINSSAKPIVYFLAGRDKSQ RLWEPLRVVFQRALRDGAEPGDAASSTPNTVTMEMQCPSGNAS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Mrgprf |
| Synonyms | Mrgprf; Mrgf; Rta; Mas-related G-protein coupled receptor member F; Mas-related gene F protein; G-protein coupled receptor RTA |
| UniProt ID | P23749 |
| ◆ Recombinant Proteins | ||
| Mrgprf-4140M | Recombinant Mouse Mrgprf Protein, Myc/DDK-tagged | +Inquiry |
| RFL18121RF | Recombinant Full Length Rat Mas-Related G-Protein Coupled Receptor Member F(Mrgprf) Protein, His-Tagged | +Inquiry |
| MRGPRF-10033M | Recombinant Mouse MRGPRF Protein | +Inquiry |
| MRGPRF-3415R | Recombinant Rat MRGPRF Protein, His (Fc)-Avi-tagged | +Inquiry |
| MRGPRF-5677M | Recombinant Mouse MRGPRF Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MRGPRF-1091HCL | Recombinant Human MRGPRF cell lysate | +Inquiry |
| MRGPRF-4205HCL | Recombinant Human MRGPRF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Mrgprf Products
Required fields are marked with *
My Review for All Mrgprf Products
Required fields are marked with *
