Recombinant Full Length Human MRPL10 Protein, GST-tagged
Cat.No. : | MRPL10-6377HF |
Product Overview : | Human MRPL10 full-length ORF ( AAH15904, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 261 amino acids |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 5q. [provided by RefSeq |
Molecular Mass : | 54.45 kDa |
AA Sequence : | MAAAVAGMLRGGLLPQAGRLPTLQTVRYGSKAVTRHRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLIRLLRREIAAVFQDNRMIAVCQNVALSAEDKLLMRHQLRKHKILMKIFPNQVLKPFLEDSKYQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLGGCIDDTILSRQGFINYSKLPSLPLVQGELVGGLTCLTAQTHSPLQHQPLQLTTLLDQYIREQREKDSVMSANGKPDPDTVPDS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPL10 mitochondrial ribosomal protein L10 [ Homo sapiens ] |
Official Symbol | MRPL10 |
Synonyms | MRPL10; mitochondrial ribosomal protein L10; 39S ribosomal protein L10, mitochondrial; 39S ribosomal protein L10; mitochondrial; L10MT; MGC17973; MRP L8; MRP L10; MRPL8; RPML8; L8mt; 39S ribosomal protein L8, mitochondrial; MRP-L8; MRP-L10; |
Gene ID | 124995 |
mRNA Refseq | NM_145255 |
Protein Refseq | NP_660298 |
MIM | 611825 |
UniProt ID | Q7Z7H8 |
◆ Recombinant Proteins | ||
MRPL10-977H | Recombinant Human MRPL10, His-tagged | +Inquiry |
MRPL10-6377HF | Recombinant Full Length Human MRPL10 Protein, GST-tagged | +Inquiry |
MRPL10-2146Z | Recombinant Zebrafish MRPL10 | +Inquiry |
MRPL10-2831R | Recombinant Rhesus monkey MRPL10 Protein, His-tagged | +Inquiry |
MRPL10-5554H | Recombinant Human MRPL10 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL10-4199HCL | Recombinant Human MRPL10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRPL10 Products
Required fields are marked with *
My Review for All MRPL10 Products
Required fields are marked with *
0
Inquiry Basket