Recombinant Full Length Human MRPL23 Protein, GST-tagged
Cat.No. : | MRPL23-6415HF |
Product Overview : | Human MRPL23 full-length ORF ( AAH27710, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 153 amino acids |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. The gene is biallelically expressed, despite its location within a region of imprinted genes on chromosome 11. [provided by RefSeq |
Molecular Mass : | 42.68 kDa |
AA Sequence : | MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPL23 mitochondrial ribosomal protein L23 [ Homo sapiens ] |
Official Symbol | MRPL23 |
Synonyms | MRPL23; mitochondrial ribosomal protein L23; RPL23L; 39S ribosomal protein L23, mitochondrial; L23MRP; L23mt; MRP-L23; L23 mitochondrial-related protein; ribosomal protein related to L23 (mitochondrial); RPL23; FLJ45387; |
Gene ID | 6150 |
mRNA Refseq | NM_021134 |
Protein Refseq | NP_066957 |
MIM | 600789 |
UniProt ID | Q16540 |
◆ Recombinant Proteins | ||
MRPL23-991H | Recombinant Human MRPL23, His-tagged | +Inquiry |
MRPL23-3768R | Recombinant Rat MRPL23 Protein | +Inquiry |
MRPL23-2840R | Recombinant Rhesus monkey MRPL23 Protein, His-tagged | +Inquiry |
MRPL23-2660R | Recombinant Rhesus Macaque MRPL23 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPL23-488H | Recombinant Human MRPL23 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL23-4186HCL | Recombinant Human MRPL23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL23 Products
Required fields are marked with *
My Review for All MRPL23 Products
Required fields are marked with *