Recombinant Full Length Human MRPL44 Protein, GST-tagged
Cat.No. : | MRPL44-6425HF |
Product Overview : | Human MRPL44 full-length ORF ( NP_075066.1, 1 a.a. - 332 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 332 amino acids |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. [provided by RefSeq |
Molecular Mass : | 63.9 kDa |
AA Sequence : | MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTLSEEFPVPPAVLQQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWKIINPMGLLVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWNYSKPKETLRAEKSITAS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPL44 mitochondrial ribosomal protein L44 [ Homo sapiens (human) ] |
Official Symbol | MRPL44 |
Synonyms | MRPL44; mitochondrial ribosomal protein L44; L44MT; COXPD16; MRP-L44; 39S ribosomal protein L44, mitochondrial; mitochondrial large ribosomal subunit protein mL44; EC 3.1.26.- |
Gene ID | 65080 |
mRNA Refseq | NM_022915 |
Protein Refseq | NP_075066 |
MIM | 611849 |
UniProt ID | Q9H9J2 |
◆ Recombinant Proteins | ||
MRPL44-339H | Recombinant Human MRPL44, His-tagged | +Inquiry |
MRPL44-4818C | Recombinant Chicken MRPL44 | +Inquiry |
MRPL44-3340Z | Recombinant Zebrafish MRPL44 | +Inquiry |
MRPL44-1095H | Recombinant Human MRPL44 | +Inquiry |
MRPL44-5704M | Recombinant Mouse MRPL44 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL44-001HCL | Recombinant Human MRPL44 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL44 Products
Required fields are marked with *
My Review for All MRPL44 Products
Required fields are marked with *