Recombinant Human MRPL54 protein, His-tagged
Cat.No. : | MRPL54-3244H |
Product Overview : | Recombinant Human MRPL54 protein(Q6P161)(15-138aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 15-138aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.2 kDa |
AA Sequence : | GWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MRPL54 mitochondrial ribosomal protein L54 [ Homo sapiens ] |
Official Symbol | MRPL54 |
Synonyms | MRPL54; mitochondrial ribosomal protein L54; 39S ribosomal protein L54, mitochondrial; L54mt; MRP-L54; |
Gene ID | 116541 |
mRNA Refseq | NM_172251 |
Protein Refseq | NP_758455 |
MIM | 611858 |
UniProt ID | Q6P161 |
◆ Recombinant Proteins | ||
MRPL54-6447HF | Recombinant Full Length Human MRPL54 Protein, GST-tagged | +Inquiry |
MRPL54-10080M | Recombinant Mouse MRPL54 Protein | +Inquiry |
MRPL54-4574H | Recombinant Human MRPL54 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MRPL54-5710M | Recombinant Mouse MRPL54 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPL54-1016H | Recombinant Human MRPL54, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL54-4155HCL | Recombinant Human MRPL54 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL54 Products
Required fields are marked with *
My Review for All MRPL54 Products
Required fields are marked with *