Recombinant Full Length Human MRPS36 Protein, GST-tagged

Cat.No. : MRPS36-6507HF
Product Overview : Human MRPS36 full-length ORF ( NP_150597.1, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 103 amino acids
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. The mitochondrial ribosome (mitoribosome) consists of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 3p, 4q, 8p, 11q, 12q, and 20p. [provided by RefSeq
Molecular Mass : 37.9 kDa
AA Sequence : MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEFIQRGGPE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MRPS36 mitochondrial ribosomal protein S36 [ Homo sapiens ]
Official Symbol MRPS36
Synonyms MRPS36; mitochondrial ribosomal protein S36; 28S ribosomal protein S36, mitochondrial; DC47; MRP S36; S36mt; MRP-S36; MGC22896;
Gene ID 92259
mRNA Refseq NM_033281
Protein Refseq NP_150597
MIM 611996
UniProt ID P82909

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPS36 Products

Required fields are marked with *

My Review for All MRPS36 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon