Recombinant Human MRPS36 Protein, GST-tagged
Cat.No. : | MRPS36-5623H |
Product Overview : | Human MRPS36 full-length ORF ( NP_150597.1, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. The mitochondrial ribosome (mitoribosome) consists of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 3p, 4q, 8p, 11q, 12q, and 20p. [provided by RefSeq |
Molecular Mass : | 37.9 kDa |
AA Sequence : | MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEFIQRGGPE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPS36 mitochondrial ribosomal protein S36 [ Homo sapiens ] |
Official Symbol | MRPS36 |
Synonyms | MRPS36; mitochondrial ribosomal protein S36; 28S ribosomal protein S36, mitochondrial; DC47; MRP S36; S36mt; MRP-S36; MGC22896; |
Gene ID | 92259 |
mRNA Refseq | NM_033281 |
Protein Refseq | NP_150597 |
MIM | 611996 |
UniProt ID | P82909 |
◆ Recombinant Proteins | ||
MRPS36-2688R | Recombinant Rhesus Macaque MRPS36 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS36-2868R | Recombinant Rhesus monkey MRPS36 Protein, His-tagged | +Inquiry |
MRPS36-1040H | Recombinant Human MRPS36, GST-tagged | +Inquiry |
MRPS36-6507HF | Recombinant Full Length Human MRPS36 Protein, GST-tagged | +Inquiry |
MRPS36-5623H | Recombinant Human MRPS36 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS36-4134HCL | Recombinant Human MRPS36 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS36 Products
Required fields are marked with *
My Review for All MRPS36 Products
Required fields are marked with *