Recombinant Full Length Human MS4A3 Protein, GST-tagged
Cat.No. : | MS4A3-6541HF |
Product Overview : | Human MS4A3 full-length ORF ( AAH08487, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 214 amino acids |
Description : | This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member likely plays a role in signal transduction and may function as a subunit associated with receptor complexes. The gene encoding this protein is localized to 11q12, among a cluster of related family members. Alternative splicing may result in multiple transcript variants; however, not all variants have been fully described. [provided by RefSeq |
Molecular Mass : | 49.28 kDa |
AA Sequence : | MASHEVDNAELGSASARGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAAMILALGVFLGSLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQNSFGMNIASATIALVGTAFLSLNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLILTLLELCVTISTIAMWCNANCCNSREEISSPPNSV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MS4A3 membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific) [ Homo sapiens ] |
Official Symbol | MS4A3 |
Synonyms | MS4A3; membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific); CD20L; membrane-spanning 4-domains subfamily A member 3; HTM4; CD20 antigen homolog; IgE receptor beta chain; CD20 antigen-like protein; IgE receptor beta subunit; hematopoietic cell 4 transmembrane protein; hematopoietic-specific transmembrane protein 4; |
Gene ID | 932 |
mRNA Refseq | NM_001031666 |
Protein Refseq | NP_001026836 |
MIM | 606498 |
UniProt ID | Q96HJ5 |
◆ Cell & Tissue Lysates | ||
MS4A3-4125HCL | Recombinant Human MS4A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MS4A3 Products
Required fields are marked with *
My Review for All MS4A3 Products
Required fields are marked with *
0
Inquiry Basket