Recombinant Human MS4A3 Protein, GST-tagged

Cat.No. : MS4A3-5636H
Product Overview : Human MS4A3 full-length ORF ( AAH08487, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member likely plays a role in signal transduction and may function as a subunit associated with receptor complexes. The gene encoding this protein is localized to 11q12, among a cluster of related family members. Alternative splicing may result in multiple transcript variants; however, not all variants have been fully described. [provided by RefSeq
Molecular Mass : 49.28 kDa
AA Sequence : MASHEVDNAELGSASARGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAAMILALGVFLGSLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQNSFGMNIASATIALVGTAFLSLNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLILTLLELCVTISTIAMWCNANCCNSREEISSPPNSV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MS4A3 membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific) [ Homo sapiens ]
Official Symbol MS4A3
Synonyms MS4A3; membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific); CD20L; membrane-spanning 4-domains subfamily A member 3; HTM4; CD20 antigen homolog; IgE receptor beta chain; CD20 antigen-like protein; IgE receptor beta subunit; hematopoietic cell 4 transmembrane protein; hematopoietic-specific transmembrane protein 4;
Gene ID 932
mRNA Refseq NM_001031666
Protein Refseq NP_001026836
MIM 606498
UniProt ID Q96HJ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MS4A3 Products

Required fields are marked with *

My Review for All MS4A3 Products

Required fields are marked with *

0
cart-icon