Recombinant Full Length Human MSANTD1 Protein, GST-tagged

Cat.No. : MSANTD1-3910HF
Product Overview : Human C4orf44 full-length ORF (BAC86436.1, 1 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 267 amino acids
Description : MSANTD1 (Myb/SANT DNA Binding Domain Containing 1) is a Protein Coding gene.
Molecular Mass : 56.6 kDa
AA Sequence : MVRGAGPGPSLSALSHPTGASGMAAAEGPGYLVSPQAEKHRRARNWTDAEMRGLMLVWEEFFDGLKQTKRNAKVYEKMASKLFEMTGERRLGEEIKIKITNMTFQYRKLKCMTDSESAPPDWPYYLAIDGILAKVPESCDGKLPDSQPPGPSTSQTEASLSPPAKSTPLYFPYNQCSYEGRFEDDRSDSSSSLLSLKFRSEERPVKKRKVQSCHLQKKQLRLLEAMVEEQRRLSRAVEETCREISRCYSTVCRRGCPVAMEWLWTLS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MSANTD1 Myb/SANT DNA binding domain containing 1 [ Homo sapiens (human) ]
Official Symbol MSANTD1
Synonyms C4orf44; MSANTD1; Myb/SANT DNA binding domain containing 1; myb/SANT-like DNA-binding domain-containing protein 1; Myb/SANT-like DNA-binding domain containing 1
Gene ID 345222
mRNA Refseq NM_001042690
Protein Refseq NP_001036155
UniProt ID Q6ZTZ1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MSANTD1 Products

Required fields are marked with *

My Review for All MSANTD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon