Recombinant Full Length Human MSANTD1 Protein, GST-tagged
Cat.No. : | MSANTD1-3910HF |
Product Overview : | Human C4orf44 full-length ORF (BAC86436.1, 1 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 267 amino acids |
Description : | MSANTD1 (Myb/SANT DNA Binding Domain Containing 1) is a Protein Coding gene. |
Molecular Mass : | 56.6 kDa |
AA Sequence : | MVRGAGPGPSLSALSHPTGASGMAAAEGPGYLVSPQAEKHRRARNWTDAEMRGLMLVWEEFFDGLKQTKRNAKVYEKMASKLFEMTGERRLGEEIKIKITNMTFQYRKLKCMTDSESAPPDWPYYLAIDGILAKVPESCDGKLPDSQPPGPSTSQTEASLSPPAKSTPLYFPYNQCSYEGRFEDDRSDSSSSLLSLKFRSEERPVKKRKVQSCHLQKKQLRLLEAMVEEQRRLSRAVEETCREISRCYSTVCRRGCPVAMEWLWTLS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MSANTD1 Myb/SANT DNA binding domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | MSANTD1 |
Synonyms | C4orf44; MSANTD1; Myb/SANT DNA binding domain containing 1; myb/SANT-like DNA-binding domain-containing protein 1; Myb/SANT-like DNA-binding domain containing 1 |
Gene ID | 345222 |
mRNA Refseq | NM_001042690 |
Protein Refseq | NP_001036155 |
UniProt ID | Q6ZTZ1 |
◆ Recombinant Proteins | ||
MSANTD1-3910HF | Recombinant Full Length Human MSANTD1 Protein, GST-tagged | +Inquiry |
MSANTD1-1931H | Recombinant Human MSANTD1 Protein, MYC/DDK-tagged | +Inquiry |
Msantd1-4180M | Recombinant Mouse Msantd1 Protein, Myc/DDK-tagged | +Inquiry |
MSANTD1-5251H | Recombinant Human MSANTD1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MSANTD1 Products
Required fields are marked with *
My Review for All MSANTD1 Products
Required fields are marked with *
0
Inquiry Basket