Recombinant Human MSANTD1 Protein, GST-tagged
| Cat.No. : | MSANTD1-5251H |
| Product Overview : | Human C4orf44 full-length ORF (BAC86436.1, 1 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | MSANTD1 (Myb/SANT DNA Binding Domain Containing 1) is a Protein Coding gene. |
| Molecular Mass : | 56.6 kDa |
| AA Sequence : | MVRGAGPGPSLSALSHPTGASGMAAAEGPGYLVSPQAEKHRRARNWTDAEMRGLMLVWEEFFDGLKQTKRNAKVYEKMASKLFEMTGERRLGEEIKIKITNMTFQYRKLKCMTDSESAPPDWPYYLAIDGILAKVPESCDGKLPDSQPPGPSTSQTEASLSPPAKSTPLYFPYNQCSYEGRFEDDRSDSSSSLLSLKFRSEERPVKKRKVQSCHLQKKQLRLLEAMVEEQRRLSRAVEETCREISRCYSTVCRRGCPVAMEWLWTLS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MSANTD1 Myb/SANT DNA binding domain containing 1 [ Homo sapiens (human) ] |
| Official Symbol | MSANTD1 |
| Synonyms | C4orf44; MSANTD1; Myb/SANT DNA binding domain containing 1; myb/SANT-like DNA-binding domain-containing protein 1; Myb/SANT-like DNA-binding domain containing 1 |
| Gene ID | 345222 |
| mRNA Refseq | NM_001042690 |
| Protein Refseq | NP_001036155 |
| UniProt ID | Q6ZTZ1 |
| ◆ Recombinant Proteins | ||
| MSANTD1-5251H | Recombinant Human MSANTD1 Protein, GST-tagged | +Inquiry |
| MSANTD1-3910HF | Recombinant Full Length Human MSANTD1 Protein, GST-tagged | +Inquiry |
| MSANTD1-1931H | Recombinant Human MSANTD1 Protein, MYC/DDK-tagged | +Inquiry |
| Msantd1-4180M | Recombinant Mouse Msantd1 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSANTD1 Products
Required fields are marked with *
My Review for All MSANTD1 Products
Required fields are marked with *



