Recombinant Full Length Human MSH2 Protein, GST-tagged
Cat.No. : | MSH2-6982HF |
Product Overview : | Recombinant Human full-length MSH2(1 a.a. - 934 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 934 amino acids |
Description : | This locus is frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 131.1 kDa |
AA Sequence : | MAVQPKETLQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNL QSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGV KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECVLPGGETAGDMGKLRQIIQRGGILIT ERKKADFSTKDIYQDLNRLLKGKKGEQMNS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | MSH2 mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) [ Homo sapiens ] |
Official Symbol | MSH2 |
Synonyms | MSH2; mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli); COCA1, mutS (E. coli) homolog 2 (colon cancer, nonpolyposis type 1); DNA mismatch repair protein Msh2; HNPCC; HNPCC1; hMSH2; FCC1; COCA1; LCFS2; |
Gene ID | 4436 |
mRNA Refseq | NM_000251 |
Protein Refseq | NP_000242 |
MIM | 609309 |
UniProt ID | P43246 |
◆ Recombinant Proteins | ||
Msh2-4186M | Recombinant Mouse Msh2 Protein, Myc/DDK-tagged | +Inquiry |
MSH2-162H | Recombinant Human MSH2 | +Inquiry |
MSH2-5739M | Recombinant Mouse MSH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MSH2-28793TH | Recombinant Human MSH2 | +Inquiry |
MSH2-10131M | Recombinant Mouse MSH2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSH2-4120HCL | Recombinant Human MSH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSH2 Products
Required fields are marked with *
My Review for All MSH2 Products
Required fields are marked with *
0
Inquiry Basket