Recombinant Full Length Human MSI1 Protein, C-Flag-tagged
Cat.No. : | MSI1-1529HFL |
Product Overview : | Recombinant Full Length Human MSI1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38.9 kDa |
AA Sequence : | METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMD QAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAML MFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAF MLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAA AVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGG PLIATAFTNGYHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | MSI1 musashi RNA binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | MSI1 |
Synonyms | musashi 1; musashi homolog 1 |
Gene ID | 4440 |
mRNA Refseq | NM_002442.4 |
Protein Refseq | NP_002433.1 |
MIM | 603328 |
UniProt ID | O43347 |
◆ Recombinant Proteins | ||
MSI1-317HF | Recombinant Full Length Human MSI1 Protein | +Inquiry |
MSI1-1529HFL | Recombinant Full Length Human MSI1 Protein, C-Flag-tagged | +Inquiry |
MSI1-3789R | Recombinant Rat MSI1 Protein | +Inquiry |
Msi1-4188M | Recombinant Mouse Msi1 Protein, Myc/DDK-tagged | +Inquiry |
MSI1-3448R | Recombinant Rat MSI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSI1-4116HCL | Recombinant Human MSI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MSI1 Products
Required fields are marked with *
My Review for All MSI1 Products
Required fields are marked with *
0
Inquiry Basket