Recombinant Full Length Human MT3 Protein

• Cat.No.: MT3-320HF
• Product Overview: Recombinant full length Human MT3 with N-terminal proprietary tag. Predicted MW 33.48kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 68 amino acids
• Description: Metallothionein-3 is a protein that in humans is encoded by the MT3 gene.
• Form: Liquid
• Molecular Mass: 33.480kDa inclusive of tags
• AA Sequence: MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: MT3 metallothionein 3 [ Homo sapiens ]
• Official Symbol: MT3
• Synonyms: MT3; metallothionein 3; metallothionein 3 (growth inhibitory factor (neurotrophic)); metallothionein-3; GIF
• Gene ID: 4504
• mRNA Refseq: NM_005954
• Protein Refseq: NP_005945
• MIM: 139255
• UniProt ID: P25713