Recombinant Full Length Human MT3 Protein

Cat.No. : MT3-320HF
Product Overview : Recombinant full length Human MT3 with N-terminal proprietary tag. Predicted MW 33.48kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 68 amino acids
Description : Metallothionein-3 is a protein that in humans is encoded by the MT3 gene.
Form : Liquid
Molecular Mass : 33.480kDa inclusive of tags
AA Sequence : MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name MT3 metallothionein 3 [ Homo sapiens ]
Official Symbol MT3
Synonyms MT3; metallothionein 3; metallothionein 3 (growth inhibitory factor (neurotrophic)); metallothionein-3; GIF
Gene ID 4504
mRNA Refseq NM_005954
Protein Refseq NP_005945
MIM 139255
UniProt ID P25713

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MT3 Products

Required fields are marked with *

My Review for All MT3 Products

Required fields are marked with *

0
cart-icon