Recombinant Full Length Human MT3 Protein
Cat.No. : | MT3-320HF |
Product Overview : | Recombinant full length Human MT3 with N-terminal proprietary tag. Predicted MW 33.48kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 68 amino acids |
Description : | Metallothionein-3 is a protein that in humans is encoded by the MT3 gene. |
Form : | Liquid |
Molecular Mass : | 33.480kDa inclusive of tags |
AA Sequence : | MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | MT3 metallothionein 3 [ Homo sapiens ] |
Official Symbol | MT3 |
Synonyms | MT3; metallothionein 3; metallothionein 3 (growth inhibitory factor (neurotrophic)); metallothionein-3; GIF |
Gene ID | 4504 |
mRNA Refseq | NM_005954 |
Protein Refseq | NP_005945 |
MIM | 139255 |
UniProt ID | P25713 |
◆ Recombinant Proteins | ||
MT3-4616H | Recombinant Human MT3 Protein (Met1-Gln68), N-GST tagged | +Inquiry |
MT3-3459R | Recombinant Rat MT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MT3-29501TH | Recombinant Human MT3 | +Inquiry |
MT3-10159M | Recombinant Mouse MT3 Protein | +Inquiry |
MT3-5039H | Recombinant Human MT3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT3-4095HCL | Recombinant Human MT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MT3 Products
Required fields are marked with *
My Review for All MT3 Products
Required fields are marked with *
0
Inquiry Basket