Recombinant Full Length Human MUTED Protein, GST-tagged

Cat.No. : MUTED-6580HF
Product Overview : Human MUTED full-length ORF ( NP_958437.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 187 amino acids
Description : This gene encodes a component of BLOC-1 (biogenesis of lysosome-related organelles complex 1). Components of this complex are involved in the biogenesis of organelles such as melanosomes and platelet-dense granules. A mouse model for Hermansky-Pudlak Syndrome is mutated in the murine version of this gene. Some transcripts of the downstream gene TXNDC5 overlap this gene, but they do not contain an open reading frame for this gene. [provided by RefSeq
Molecular Mass : 48 kDa
AA Sequence : MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGLREMRVLENLKNMIHETNEHTLPKCRDTMRDSLSQVLQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQHMLQWDNFMKEQPNKRAEVDEEHRKAMERLKEQYAEMEKDLAKFSTF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MUTED muted homolog (mouse) [ Homo sapiens ]
Official Symbol MUTED
Synonyms MUTED; muted homolog (mouse); protein Muted homolog; dJ303A1.3; MU; FLJ18427; DKFZp686E2287;
Gene ID 63915
mRNA Refseq NM_001199322
Protein Refseq NP_001186251
MIM 607289
UniProt ID Q8TDH9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MUTED Products

Required fields are marked with *

My Review for All MUTED Products

Required fields are marked with *

0
cart-icon
0
compare icon