Recombinant Human MUTED Protein, GST-tagged
Cat.No. : | MUTED-5763H |
Product Overview : | Human MUTED full-length ORF ( NP_958437.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a component of BLOC-1 (biogenesis of lysosome-related organelles complex 1). Components of this complex are involved in the biogenesis of organelles such as melanosomes and platelet-dense granules. A mouse model for Hermansky-Pudlak Syndrome is mutated in the murine version of this gene. Some transcripts of the downstream gene TXNDC5 overlap this gene, but they do not contain an open reading frame for this gene. [provided by RefSeq |
Molecular Mass : | 48 kDa |
AA Sequence : | MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGLREMRVLENLKNMIHETNEHTLPKCRDTMRDSLSQVLQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQHMLQWDNFMKEQPNKRAEVDEEHRKAMERLKEQYAEMEKDLAKFSTF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MUTED muted homolog (mouse) [ Homo sapiens ] |
Official Symbol | MUTED |
Synonyms | MUTED; muted homolog (mouse); protein Muted homolog; dJ303A1.3; MU; FLJ18427; DKFZp686E2287; |
Gene ID | 63915 |
mRNA Refseq | NM_001199322 |
Protein Refseq | NP_001186251 |
MIM | 607289 |
UniProt ID | Q8TDH9 |
◆ Recombinant Proteins | ||
MUTED-5763H | Recombinant Human MUTED Protein, GST-tagged | +Inquiry |
MUTED-6580HF | Recombinant Full Length Human MUTED Protein, GST-tagged | +Inquiry |
MUTED-6946H | Recombinant Human Muted Homolog (mouse), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MUTED-4053HCL | Recombinant Human MUTED 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MUTED Products
Required fields are marked with *
My Review for All MUTED Products
Required fields are marked with *
0
Inquiry Basket