Recombinant Full Length Human MVB12B Protein, GST-tagged

Cat.No. : MVB12B-4519HF
Product Overview : Human FAM125B full-length ORF ( NP_001011703.1, 1 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 221 amino acids
Description : The protein encoded by this gene is a component of the ESCRT-I complex, a heterotetramer, which mediates the sorting of ubiquitinated cargo protein from the plasma membrane to the endosomal vesicle. ESCRT-I complex plays an essential role in HIV budding and endosomal protein sorting. Depletion and overexpression of this and related protein (MVB12A) inhibit HIV-1 infectivity and induce unusual viral assembly defects, indicating a role for MVB12 subunits in regulating ESCRT-mediated virus budding. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
Molecular Mass : 50.9 kDa
AA Sequence : MRSCFCVRRSRDPPPPQPPPPPPQRGTDQSTMPEVKDLSEALPETSMDPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTTPSQSSAASTPAPNLPR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MVB12B multivesicular body subunit 12B [ Homo sapiens (human) ]
Official Symbol MVB12B
Synonyms FAM125B; family with sequence similarity 125, member B; C9orf28, chromosome 9 open reading frame 28; multivesicular body subunit 12B; FLJ00001; ESCRT-I complex subunit MVB12B; MVB12B; C9orf28; MVB12B; multivesicular body subunit 12B
Gene ID 89853
mRNA Refseq NM_001011703
Protein Refseq NP_001011703
UniProt ID Q9H7P6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MVB12B Products

Required fields are marked with *

My Review for All MVB12B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon