Recombinant Human MVB12B Protein, GST-tagged
Cat.No. : | MVB12B-3694H |
Product Overview : | Human FAM125B full-length ORF ( NP_001011703.1, 1 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a component of the ESCRT-I complex, a heterotetramer, which mediates the sorting of ubiquitinated cargo protein from the plasma membrane to the endosomal vesicle. ESCRT-I complex plays an essential role in HIV budding and endosomal protein sorting. Depletion and overexpression of this and related protein (MVB12A) inhibit HIV-1 infectivity and induce unusual viral assembly defects, indicating a role for MVB12 subunits in regulating ESCRT-mediated virus budding. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 50.9 kDa |
AA Sequence : | MRSCFCVRRSRDPPPPQPPPPPPQRGTDQSTMPEVKDLSEALPETSMDPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTTPSQSSAASTPAPNLPR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MVB12B multivesicular body subunit 12B [ Homo sapiens (human) ] |
Official Symbol | MVB12B |
Synonyms | FAM125B; family with sequence similarity 125, member B; C9orf28, chromosome 9 open reading frame 28; multivesicular body subunit 12B; FLJ00001; ESCRT-I complex subunit MVB12B; MVB12B; C9orf28; MVB12B; multivesicular body subunit 12B |
Gene ID | 89853 |
mRNA Refseq | NM_001011703 |
Protein Refseq | NP_001011703 |
UniProt ID | Q9H7P6 |
◆ Recombinant Proteins | ||
Mvb12b-4228M | Recombinant Mouse Mvb12b Protein, Myc/DDK-tagged | +Inquiry |
MVB12B-4519HF | Recombinant Full Length Human MVB12B Protein, GST-tagged | +Inquiry |
MVB12B-2381C | Recombinant Chicken MVB12B | +Inquiry |
MVB12B-2337H | Recombinant Human MVB12B Protein, MYC/DDK-tagged | +Inquiry |
MVB12B-3694H | Recombinant Human MVB12B Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MVB12B Products
Required fields are marked with *
My Review for All MVB12B Products
Required fields are marked with *