Recombinant Full Length Human MYCBP Protein, GST-tagged
| Cat.No. : | MYCBP-6728HF |
| Product Overview : | Human MYCBP full-length ORF ( AAH08686, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 103 amino acids |
| Description : | The MYCBP gene encodes a protein that binds to the N-terminal region of MYC (MIM 190080) and stimulates the activation of E box-dependent transcription by MYC.[supplied by OMIM |
| Molecular Mass : | 37.07 kDa |
| AA Sequence : | MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MYCBP c-myc binding protein [ Homo sapiens ] |
| Official Symbol | MYCBP |
| Synonyms | MYCBP; c-myc binding protein; C-Myc-binding protein; AMY 1; associate of myc 1; associate of myc-1; AMY-1; FLJ41056; |
| Gene ID | 26292 |
| mRNA Refseq | NM_012333 |
| Protein Refseq | NP_036465 |
| MIM | 606535 |
| UniProt ID | Q99417 |
| ◆ Recombinant Proteins | ||
| MYCBP-3721Z | Recombinant Zebrafish MYCBP | +Inquiry |
| Mycbp-4240M | Recombinant Mouse Mycbp Protein, Myc/DDK-tagged | +Inquiry |
| MYCBP-4750H | Recombinant Human MYCBP protein, His-SUMO-tagged | +Inquiry |
| MYCBP-6874H | Recombinant Human C-Myc Binding Protein, His-tagged | +Inquiry |
| MYCBP-6398H | Recombinant Human MYCBP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYCBP-4038HCL | Recombinant Human MYCBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYCBP Products
Required fields are marked with *
My Review for All MYCBP Products
Required fields are marked with *
