Recombinant Human MYCBP Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MYCBP-6398H |
| Product Overview : | MYCBP MS Standard C13 and N15-labeled recombinant protein (NP_036465) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene binds to the N-terminus of the oncogenic protein C-MYC, enhancing the ability of C-MYC to activate E box-dependent transcription. The encoded protein is normally found in the cytoplasm, but it translocates to the nucleus during S phase of the cell cycle and associates with C-MYC. This protein may be involved in spermatogenesis. This gene can be silenced by microRNA-22. Two transcript variants, one protein-coding and the other probably not protein-coding, have been found for this gene. |
| Molecular Mass : | 12 kDa |
| AA Sequence : | MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MYCBP c-myc binding protein [ Homo sapiens (human) ] |
| Official Symbol | MYCBP |
| Synonyms | MYCBP; c-myc binding protein; C-Myc-binding protein; AMY 1; associate of myc 1; associate of myc-1; AMY-1; FLJ41056; |
| Gene ID | 26292 |
| mRNA Refseq | NM_012333 |
| Protein Refseq | NP_036465 |
| MIM | 606535 |
| UniProt ID | Q99417 |
| ◆ Recombinant Proteins | ||
| MYCBP-5860H | Recombinant Human MYCBP protein | +Inquiry |
| MYCBP-4750H | Recombinant Human MYCBP protein, His-SUMO-tagged | +Inquiry |
| MYCBP-6398H | Recombinant Human MYCBP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MYCBP-801H | Recombinant Human MYCBP Protein, His-tagged | +Inquiry |
| MYCBP-3721Z | Recombinant Zebrafish MYCBP | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYCBP-4038HCL | Recombinant Human MYCBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYCBP Products
Required fields are marked with *
My Review for All MYCBP Products
Required fields are marked with *
