Recombinant Full Length Human MYEOV2 Protein, GST-tagged
Cat.No. : | MYEOV2-6734HF |
Product Overview : | Human MYEOV2 full-length ORF ( NP_612209.1, 1 a.a. - 252 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 252 amino acids |
Description : | COPS9 (COP9 Signalosome Subunit 9) is a Protein Coding gene. |
Molecular Mass : | 54.12 kDa |
AA Sequence : | MWRAPEAALRPEVSLERRGPEMKPAVDEMFPEGAGPYVDLDEVARARRESPSAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDIHSSGLPRTSQQSSMVPALQRGQSEHGVRGKAAERPVVSEERCELNGREVAALDRAFGSTGHGQGAEALMFTRCREHPLCGTNKATSEGKMGTGRLRNSLRKNQSKWLGSYLEVLRTTRSRREVSEDSTISVSTHWRGKCFKSDETPSVAGGEEGKKTTQPCIDVR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYEOV2 myeloma overexpressed 2 [ Homo sapiens ] |
Official Symbol | MYEOV2 |
Synonyms | MYEOV2; myeloma overexpressed 2 |
Gene ID | 150678 |
mRNA Refseq | NM_138336 |
Protein Refseq | NP_612209 |
MIM | 619349 |
UniProt ID | Q8WXC6 |
◆ Recombinant Proteins | ||
MYEOV2-6734HF | Recombinant Full Length Human MYEOV2 Protein, GST-tagged | +Inquiry |
MYEOV2-11099Z | Recombinant Zebrafish MYEOV2 | +Inquiry |
MYEOV2-5078C | Recombinant Chicken MYEOV2 | +Inquiry |
MYEOV2-2490H | Recombinant Human MYEOV2 protein, His-tagged | +Inquiry |
MYEOV2-5800H | Recombinant Human MYEOV2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYEOV2 Products
Required fields are marked with *
My Review for All MYEOV2 Products
Required fields are marked with *