Recombinant Human MYEOV2 Protein, GST-tagged

Cat.No. : MYEOV2-5800H
Product Overview : Human MYEOV2 full-length ORF ( NP_612209.1, 1 a.a. - 252 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : COPS9 (COP9 Signalosome Subunit 9) is a Protein Coding gene.
Molecular Mass : 54.12 kDa
AA Sequence : MWRAPEAALRPEVSLERRGPEMKPAVDEMFPEGAGPYVDLDEVARARRESPSAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDIHSSGLPRTSQQSSMVPALQRGQSEHGVRGKAAERPVVSEERCELNGREVAALDRAFGSTGHGQGAEALMFTRCREHPLCGTNKATSEGKMGTGRLRNSLRKNQSKWLGSYLEVLRTTRSRREVSEDSTISVSTHWRGKCFKSDETPSVAGGEEGKKTTQPCIDVR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYEOV2 myeloma overexpressed 2 [ Homo sapiens ]
Official Symbol MYEOV2
Synonyms MYEOV2; myeloma overexpressed 2
Gene ID 150678
mRNA Refseq NM_138336
Protein Refseq NP_612209
UniProt ID Q8WXC6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYEOV2 Products

Required fields are marked with *

My Review for All MYEOV2 Products

Required fields are marked with *

0
cart-icon