Recombinant Full Length Human MYL1 Protein, GST-tagged
Cat.No. : | MYL1-6758HF |
Product Overview : | Human MYL1 full-length ORF ( NP_524144.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 194 amino acids |
Description : | Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. [provided by RefSeq |
Molecular Mass : | 47.5 kDa |
AA Sequence : | MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYL1 myosin light chain 1 [ Homo sapiens (human) ] |
Official Symbol | MYL1 |
Synonyms | MYL1; myosin, light chain 1, alkali; skeletal, fast; myosin, light polypeptide 1, alkali; skeletal, fast; myosin light chain 1/3, skeletal muscle isoform; MLC1/MLC3; MLC1F/MLC3F; A1 catalytic; A2 catalytic; myosin light chain A1/A2; myosin light chain alkali 1/2; myosin, light polypeptide 1, alkali; skeletal, fast; MLC1F; MLC3F; |
Gene ID | 4632 |
mRNA Refseq | NM_079420 |
Protein Refseq | NP_524144 |
MIM | 160780 |
UniProt ID | P05976 |
◆ Recombinant Proteins | ||
MYL1-1507H | Recombinant Human MYL1 protein, His-tagged | +Inquiry |
MYL1-10310M | Recombinant Mouse MYL1 Protein | +Inquiry |
MYL1-3851R | Recombinant Rat MYL1 Protein | +Inquiry |
Myl1-1508R | Recombinant Rat Myl1 protein, His-tagged | +Inquiry |
MYL1-3261H | Recombinant Human MYL1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL1-4031HCL | Recombinant Human MYL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYL1 Products
Required fields are marked with *
My Review for All MYL1 Products
Required fields are marked with *
0
Inquiry Basket