Recombinant Full Length Human MYL4 Protein, GST-tagged

Cat.No. : MYL4-6761HF
Product Overview : Human MYL4 full-length ORF ( AAH30228, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 197 amino acids
Description : Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Molecular Mass : 47.41 kDa
AA Sequence : MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYL4 myosin light chain 4 [ Homo sapiens (human) ]
Official Symbol MYL4
Synonyms MYL4; myosin, light chain 4, alkali; atrial, embryonic; myosin, light polypeptide 4, alkali; atrial, embryonic; myosin light chain 4; ALC1; AMLC; GT1; myosin; atrial/fetal muscle; light chain; PRO1957; myosin light chain alkali GT-1 isoform; myosin, atrial/fetal muscle, light chain; myosin light chain 1, embryonic muscle/atrial isoform; myosin, light polypeptide 4, alkali; atrial, embryonic;
Gene ID 4635
mRNA Refseq NM_001002841
Protein Refseq NP_001002841
MIM 160770
UniProt ID P12829

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYL4 Products

Required fields are marked with *

My Review for All MYL4 Products

Required fields are marked with *

0
cart-icon