Recombinant Full Length Human MYL4 Protein, GST-tagged
Cat.No. : | MYL4-6761HF |
Product Overview : | Human MYL4 full-length ORF ( AAH30228, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 197 amino acids |
Description : | Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq |
Molecular Mass : | 47.41 kDa |
AA Sequence : | MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYL4 myosin light chain 4 [ Homo sapiens (human) ] |
Official Symbol | MYL4 |
Synonyms | MYL4; myosin, light chain 4, alkali; atrial, embryonic; myosin, light polypeptide 4, alkali; atrial, embryonic; myosin light chain 4; ALC1; AMLC; GT1; myosin; atrial/fetal muscle; light chain; PRO1957; myosin light chain alkali GT-1 isoform; myosin, atrial/fetal muscle, light chain; myosin light chain 1, embryonic muscle/atrial isoform; myosin, light polypeptide 4, alkali; atrial, embryonic; |
Gene ID | 4635 |
mRNA Refseq | NM_001002841 |
Protein Refseq | NP_001002841 |
MIM | 160770 |
UniProt ID | P12829 |
◆ Recombinant Proteins | ||
MYL4-5811H | Recombinant Human MYL4 Protein, GST-tagged | +Inquiry |
MYL4-3085Z | Recombinant Zebrafish MYL4 | +Inquiry |
MYL4-30265TH | Recombinant Human MYL4, His-tagged | +Inquiry |
MYL4-1565H | Recombinant Human MYL4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MYL4-6857H | Recombinant Human Myosin, Light Chain 4, Alkali; Atrial, Embryonic, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL4-4026HCL | Recombinant Human MYL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL4 Products
Required fields are marked with *
My Review for All MYL4 Products
Required fields are marked with *