Recombinant Human MYL4, His-tagged
| Cat.No. : | MYL4-30265TH |
| Product Overview : | Recombinant full length Human MYL4 (amino acids 1-197) with a C terminal His tag; 205aa, 22.6kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 197 amino acids |
| Description : | Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. |
| Conjugation : | HIS |
| Molecular Weight : | 22.600kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT, 0.88% Sodium chloride |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFD PKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGD VLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPIL QHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLA TLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSGLEH HHHHH |
| Sequence Similarities : | Contains 3 EF-hand domains. |
| Gene Name | MYL4 myosin, light chain 4, alkali; atrial, embryonic [ Homo sapiens ] |
| Official Symbol | MYL4 |
| Synonyms | MYL4; myosin, light chain 4, alkali; atrial, embryonic; myosin, light polypeptide 4, alkali; atrial, embryonic; myosin light chain 4; ALC1; AMLC; GT1; myosin; atrial/fetal muscle; light chain; PRO1957; |
| Gene ID | 4635 |
| mRNA Refseq | NM_001002841 |
| Protein Refseq | NP_001002841 |
| MIM | 160770 |
| Uniprot ID | P12829 |
| Chromosome Location | 17q21-qter |
| Pathway | Muscle contraction, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem; |
| Function | actin filament binding; actin monomer binding; calcium ion binding; myosin II heavy chain binding; structural constituent of muscle; |
| ◆ Recombinant Proteins | ||
| MYL4-6857H | Recombinant Human Myosin, Light Chain 4, Alkali; Atrial, Embryonic, His-tagged | +Inquiry |
| MYL4-1355H | Recombinant Human MYL4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MYL4-5811H | Recombinant Human MYL4 Protein, GST-tagged | +Inquiry |
| MYL4-30265TH | Recombinant Human MYL4, His-tagged | +Inquiry |
| MYL4-1565H | Recombinant Human MYL4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYL4-4026HCL | Recombinant Human MYL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL4 Products
Required fields are marked with *
My Review for All MYL4 Products
Required fields are marked with *
