Recombinant Full Length Human MYL6 Protein, GST-tagged

• Cat.No.: MYL6-6763HF
• Product Overview: Human MYL6 full-length ORF ( NP_066299.2, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 151 amino acids
• Description: Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
• Molecular Mass: 43.3 kDa
• AA Sequence: MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYL6 myosin light chain 6 [ Homo sapiens (human) ]
• Official Symbol: MYL6
• Synonyms: MYL6; myosin, light chain 6, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6, alkali, smooth muscle and non muscle; myosin light polypeptide 6; ESMLC; MLC1SM; MLC3NM; myosin light chain A3; 17 kDa myosin light chain; myosin light chain alkali 3; myosin, light polypeptide 6, alkali, smooth muscle and non-muscle; LC17; LC17A; LC17B; MLC-3; MLC3SM; LC17-GI; LC17-NM
• Gene ID: 4637
• mRNA Refseq: NM_021019
• Protein Refseq: NP_066299
• MIM: 609931
• UniProt ID: P60660