Recombinant Full Length Human MYL6 Protein, GST-tagged

Cat.No. : MYL6-6763HF
Product Overview : Human MYL6 full-length ORF ( NP_066299.2, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 151 amino acids
Description : Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Molecular Mass : 43.3 kDa
AA Sequence : MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYL6 myosin light chain 6 [ Homo sapiens (human) ]
Official Symbol MYL6
Synonyms MYL6; myosin, light chain 6, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6, alkali, smooth muscle and non muscle; myosin light polypeptide 6; ESMLC; MLC1SM; MLC3NM; myosin light chain A3; 17 kDa myosin light chain; myosin light chain alkali 3; myosin, light polypeptide 6, alkali, smooth muscle and non-muscle; LC17; LC17A; LC17B; MLC-3; MLC3SM; LC17-GI; LC17-NM;
Gene ID 4637
mRNA Refseq NM_021019
Protein Refseq NP_066299
MIM 609931
UniProt ID P60660

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYL6 Products

Required fields are marked with *

My Review for All MYL6 Products

Required fields are marked with *

0
cart-icon