Recombinant Full Length Human MYOG Protein, GST-tagged

Cat.No. : MYOG-6610HF
Product Overview : Human MYOG full-length ORF ( AAH53899, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 224 amino acids
Description : Myogenin is a muscle-specific transcription factor that can induce myogenesis in a variety of cell types in tissue culture. It is a member of a large family of proteins related by sequence homology, the helix-loop-helix (HLH) proteins. It is essential for the development of functional skeletal muscle. [provided by RefSeq
Molecular Mass : 50.38 kDa
AA Sequence : MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYOG myogenin (myogenic factor 4) [ Homo sapiens ]
Official Symbol MYOG
Synonyms MYOG; myogenin (myogenic factor 4); MYF4; myogenin; bHLHc3; myf-4; myogenic factor 4; Myogenic factor-4; class C basic helix-loop-helix protein 3; MYOGENIN;
Gene ID 4656
mRNA Refseq NM_002479
Protein Refseq NP_002470
MIM 159980
UniProt ID P15173

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYOG Products

Required fields are marked with *

My Review for All MYOG Products

Required fields are marked with *

0
cart-icon
0
compare icon