Recombinant Full Length Human MYOZ2 Protein, GST-tagged
Cat.No. : | MYOZ2-6621HF |
Product Overview : | Human MYOZ2 full-length ORF ( AAH05195, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 264 amino acids |
Description : | The protein encoded by this gene belongs to a family of sarcomeric proteins that bind to calcineurin, a phosphatase involved in calcium-dependent signal transduction in diverse cell types. These family members tether calcineurin to alpha-actinin at the z-line of the sarcomere of cardiac and skeletal muscle cells, and thus they are important for calcineurin signaling. Mutations in this gene cause cardiomyopathy familial hypertrophic type 16, a hereditary heart disorder. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 54.78 kDa |
AA Sequence : | MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKRVSIPRDIMLEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIPPEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTTVPESEDL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYOZ2 myozenin 2 [ Homo sapiens ] |
Official Symbol | MYOZ2 |
Synonyms | MYOZ2; myozenin 2; C4orf5, chromosome 4 open reading frame 5; myozenin-2; CS 1; FATZ-related protein 2; muscle-specific protein; calcineurin-binding protein calsarcin-1; CS-1; CMH16; C4orf5; |
Gene ID | 51778 |
mRNA Refseq | NM_016599 |
Protein Refseq | NP_057683 |
MIM | 605602 |
UniProt ID | Q9NPC6 |
◆ Recombinant Proteins | ||
MYOZ2-5860H | Recombinant Human MYOZ2 Protein, GST-tagged | +Inquiry |
MYOZ2-2945H | Recombinant Human Myozenin 2, T7-tagged | +Inquiry |
MYOZ2-2495H | Recombinant Human MYOZ2 Protein, His-tagged | +Inquiry |
MYOZ2-5179C | Recombinant Chicken MYOZ2 | +Inquiry |
MYOZ2-3286H | Recombinant Human MYOZ2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYOZ2-4001HCL | Recombinant Human MYOZ2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYOZ2 Products
Required fields are marked with *
My Review for All MYOZ2 Products
Required fields are marked with *