Recombinant Full Length Human N6AMT1 Protein, GST-tagged
| Cat.No. : | N6AMT1-3477HF |
| Product Overview : | Human HEMK2 full-length ORF ( AAH11554.1, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 186 amino acids |
| Description : | The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq |
| Molecular Mass : | 46.2 kDa |
| AA Sequence : | MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | N6AMT1 N-6 adenine-specific DNA methyltransferase 1 (putative) [ Homo sapiens ] |
| Official Symbol | N6AMT1 |
| Synonyms | N6AMT1; N-6 adenine-specific DNA methyltransferase 1 (putative); C21orf127, chromosome 21 open reading frame 127 , HemK methyltransferase family member 2 , HEMK2; hemK methyltransferase family member 2; MTQ2; N6AMT; PRED28; m.HsaHemK2P; N6-DNA-methyltransferase; n(6)-adenine-specific DNA methyltransferase 1; HEMK2; C21orf127; FLJ11616; MGC19995; |
| Gene ID | 29104 |
| mRNA Refseq | NM_013240 |
| Protein Refseq | NP_037372 |
| MIM | 614553 |
| UniProt ID | Q9Y5N5 |
| ◆ Recombinant Proteins | ||
| N6AMT1-2530H | Recombinant Human N6AMT1 protein, His-tagged | +Inquiry |
| N6AMT1-648H | Recombinant Human N-6 adenine-specific DNA methyltransferase 1 (putative), His-tagged | +Inquiry |
| N6AMT1-3477HF | Recombinant Full Length Human N6AMT1 Protein, GST-tagged | +Inquiry |
| N6AMT1-4688H | Recombinant Human N6AMT1 Protein, GST-tagged | +Inquiry |
| N6AMT1-5346C | Recombinant Chicken N6AMT1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| N6AMT1-3996HCL | Recombinant Human N6AMT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All N6AMT1 Products
Required fields are marked with *
My Review for All N6AMT1 Products
Required fields are marked with *
