Recombinant Human N6AMT1 Protein, GST-tagged

Cat.No. : N6AMT1-4688H
Product Overview : Human HEMK2 full-length ORF ( AAH11554.1, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq
Molecular Mass : 46.2 kDa
AA Sequence : MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name N6AMT1 N-6 adenine-specific DNA methyltransferase 1 (putative) [ Homo sapiens ]
Official Symbol N6AMT1
Synonyms N6AMT1; N-6 adenine-specific DNA methyltransferase 1 (putative); C21orf127, chromosome 21 open reading frame 127 , HemK methyltransferase family member 2 , HEMK2; hemK methyltransferase family member 2; MTQ2; N6AMT; PRED28; m.HsaHemK2P; N6-DNA-methyltransferase; n(6)-adenine-specific DNA methyltransferase 1; HEMK2; C21orf127; FLJ11616; MGC19995;
Gene ID 29104
mRNA Refseq NM_013240
Protein Refseq NP_037372
MIM 614553
UniProt ID Q9Y5N5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All N6AMT1 Products

Required fields are marked with *

My Review for All N6AMT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon