Recombinant Human N6AMT1 protein, GST-tagged

Cat.No. : N6AMT1-3028H
Product Overview : Recombinant Human N6AMT1 protein(Q9Y5N5)(1-186aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-186aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 46.8 kDa
AA Sequence : MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGKNGREVMDRFFPLVPDLLSPKGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name N6AMT1 N-6 adenine-specific DNA methyltransferase 1 (putative) [ Homo sapiens ]
Official Symbol N6AMT1
Synonyms N6AMT1; N-6 adenine-specific DNA methyltransferase 1 (putative); C21orf127, chromosome 21 open reading frame 127 , HemK methyltransferase family member 2 , HEMK2; hemK methyltransferase family member 2; MTQ2; N6AMT; PRED28; m.HsaHemK2P; N6-DNA-methyltransferase; n(6)-adenine-specific DNA methyltransferase 1; HEMK2; C21orf127; FLJ11616; MGC19995;
Gene ID 29104
mRNA Refseq NM_013240
Protein Refseq NP_037372
MIM 614553
UniProt ID Q9Y5N5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All N6AMT1 Products

Required fields are marked with *

My Review for All N6AMT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon