Recombinant Human N6AMT1 protein, GST-tagged
Cat.No. : | N6AMT1-3028H |
Product Overview : | Recombinant Human N6AMT1 protein(Q9Y5N5)(1-186aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-186aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 46.8 kDa |
AA Sequence : | MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGKNGREVMDRFFPLVPDLLSPKGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | N6AMT1 N-6 adenine-specific DNA methyltransferase 1 (putative) [ Homo sapiens ] |
Official Symbol | N6AMT1 |
Synonyms | N6AMT1; N-6 adenine-specific DNA methyltransferase 1 (putative); C21orf127, chromosome 21 open reading frame 127 , HemK methyltransferase family member 2 , HEMK2; hemK methyltransferase family member 2; MTQ2; N6AMT; PRED28; m.HsaHemK2P; N6-DNA-methyltransferase; n(6)-adenine-specific DNA methyltransferase 1; HEMK2; C21orf127; FLJ11616; MGC19995; |
Gene ID | 29104 |
mRNA Refseq | NM_013240 |
Protein Refseq | NP_037372 |
MIM | 614553 |
UniProt ID | Q9Y5N5 |
◆ Recombinant Proteins | ||
N6AMT1-4688H | Recombinant Human N6AMT1 Protein, GST-tagged | +Inquiry |
N6AMT1-648H | Recombinant Human N-6 adenine-specific DNA methyltransferase 1 (putative), His-tagged | +Inquiry |
N6AMT1-2530H | Recombinant Human N6AMT1 protein, His-tagged | +Inquiry |
N6AMT1-3477HF | Recombinant Full Length Human N6AMT1 Protein, GST-tagged | +Inquiry |
N6AMT1-629Z | Recombinant Zebrafish N6AMT1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
N6AMT1-3996HCL | Recombinant Human N6AMT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All N6AMT1 Products
Required fields are marked with *
My Review for All N6AMT1 Products
Required fields are marked with *
0
Inquiry Basket