Recombinant Human N6AMT1 protein, GST-tagged

• Cat.No.: N6AMT1-3028H
• Product Overview: Recombinant Human N6AMT1 protein(Q9Y5N5)(1-186aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-186aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 46.8 kDa
• AA Sequence: MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGKNGREVMDRFFPLVPDLLSPKGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: N6AMT1 N-6 adenine-specific DNA methyltransferase 1 (putative) [ Homo sapiens ]
• Official Symbol: N6AMT1
• Synonyms: N6AMT1; N-6 adenine-specific DNA methyltransferase 1 (putative); C21orf127, chromosome 21 open reading frame 127 , HemK methyltransferase family member 2 , HEMK2; hemK methyltransferase family member 2; MTQ2; N6AMT; PRED28; m.HsaHemK2P; N6-DNA-methyltransferase; n(6)-adenine-specific DNA methyltransferase 1; HEMK2; C21orf127; FLJ11616; MGC19995
• Gene ID: 29104
• mRNA Refseq: NM_013240
• Protein Refseq: NP_037372
• MIM: 614553
• UniProt ID: Q9Y5N5