Recombinant Full Length Human NAGPA Protein, C-Flag-tagged
Cat.No. : | NAGPA-215HFL |
Product Overview : | Recombinant Full Length Human NAGPA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Hydrolases are transported to lysosomes after binding to mannose 6-phosphate receptors in the trans-Golgi network. This gene encodes the enzyme that catalyzes the second step in the formation of the mannose 6-phosphate recognition marker on lysosomal hydrolases. Commonly known as 'uncovering enzyme' or UCE, this enzyme removes N-acetyl-D-glucosamine (GlcNAc) residues from GlcNAc-alpha-P-mannose moieties and thereby produces the recognition marker. The encoded preproprotein is proteolytically processed by furin to generate the mature enzyme, a homotetramer of two disulfide-linked homodimers. Mutations in this gene are associated with developmental stuttering in human patients. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 53.3 kDa |
AA Sequence : | MATSTGRWLLLRLALFGFLWEASGGLDSGASRDDDLLLPYPRARARLPRDCTRVRAGNREHESWPPPPAT PGAGGLAVRTFVSHFRDRAVAGHLTRAVEPLRTFSVLEPGGPGGCAARRRATVEETARAADCRVAQNGGF FRMNSGECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPFVQLLSGVVWLIRNGS IYINESQATECDETQETGSFSKFVNVISARTAIGHDRKGQLVLFHADGQTEQRGINLWEMAEFLLKQDVV NAINLDGGGSATFVLNGTLASYPSDHCQDNMWRCPRQVSTVVCVHEPRCQPPDCHGHGTCVDGYCQCTGH FWRGPGCDELDCGPSNCSQHGLCTETGCRCDAGWTGSNCSEECPLGWHGPGCQRPCKCEHHCPCDPKTGN CSVSRVKQCLQPPEATLRAGELSFFTRTAWLALTLALAFLLLISIAANLSLLLSRAERNRRLHGDYAYHP LQEMNGEPLAAEKEQPGGAHNPFKDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Lysosome |
Full Length : | Full L. |
Gene Name | NAGPA N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase [ Homo sapiens (human) ] |
Official Symbol | NAGPA |
Synonyms | UCE; APAA |
Gene ID | 51172 |
mRNA Refseq | NM_016256.4 |
Protein Refseq | NP_057340.2 |
MIM | 607985 |
UniProt ID | Q9UK23 |
◆ Recombinant Proteins | ||
NAGPA-1475H | Recombinant Human NAGPA Protein, His (Fc)-Avi-tagged | +Inquiry |
NAGPA-867H | Recombinant Human NAGPA | +Inquiry |
NAGPA-189H | Recombinant Human NAGPA Protein, MYC/DDK-tagged | +Inquiry |
Nagpa-4284M | Recombinant Mouse Nagpa Protein, Myc/DDK-tagged | +Inquiry |
RFL21570BF | Recombinant Full Length Bovine N-Acetylglucosamine-1-Phosphodiester Alpha-N-Acetylglucosaminidase(Nagpa) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NAGPA Products
Required fields are marked with *
My Review for All NAGPA Products
Required fields are marked with *
0
Inquiry Basket