Recombinant Full Length Human NAT1 Protein
Cat.No. : | NAT1-328HF |
Product Overview : | Recombinant full length Human NAT1 (amino acids 1-290) with N terminal proprietary tag, 57.97 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 290 amino acids |
Description : | This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 57.970kDa inclusive of tags |
AA Sequence : | MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENL NIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALT TIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYI VDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWY LDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIE DFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLT HRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLV PKHGDRFFTI |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | NAT1 N-acetyltransferase 1 (arylamine N-acetyltransferase) [ Homo sapiens ] |
Official Symbol | NAT1 |
Synonyms | NAT1; N-acetyltransferase 1 (arylamine N-acetyltransferase); AAC1; arylamine N-acetyltransferase 1 |
Gene ID | 9 |
mRNA Refseq | NM_000662 |
Protein Refseq | NP_000653 |
MIM | 108345 |
UniProt ID | P18440 |
◆ Recombinant Proteins | ||
NAT1-2478H | Recombinant Human NAT1 Protein, His-tagged | +Inquiry |
NAT1-10434M | Recombinant Mouse NAT1 Protein | +Inquiry |
NAT1-1817H | Recombinant Human NAT1 Protein, His&GST-tagged | +Inquiry |
Nat1-405M | Recombinant Mouse Nat1 Protein, His-tagged | +Inquiry |
NAT1-3565R | Recombinant Rat NAT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAT1-1168HCL | Recombinant Human NAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAT1 Products
Required fields are marked with *
My Review for All NAT1 Products
Required fields are marked with *