Recombinant Human NAT1, Fc-tagged

Cat.No. : NAT1-30283TH
Product Overview : Recombinant fragment: DFESMNTYLQ TSPSSVFTSK SFCSLQTPDG VHCLVGFTLT HRRFNYKDNT DLIEFKTLSE EEIEKVLKNI FNISLQRKLV PKHGDRFFTI of Human NAT1 (amino acids 201-290) with N terminal proprietary tag, 35.53 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Fc
Protein Length : 90 amino acids
Description : This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene.
Conjugation : Fc
Molecular Weight : 35.530kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI
Sequence Similarities : Belongs to the arylamine N-acetyltransferase family.
Gene Name NAT1 N-acetyltransferase 1 (arylamine N-acetyltransferase) [ Homo sapiens ]
Official Symbol NAT1
Synonyms NAT1; N-acetyltransferase 1 (arylamine N-acetyltransferase); AAC1; arylamine N-acetyltransferase 1;
Gene ID 9
mRNA Refseq NM_000662
Protein Refseq NP_000653
MIM 108345
Uniprot ID P18440
Chromosome Location 8p22
Pathway Acetylation, organism-specific biosystem; Biological oxidations, organism-specific biosystem; Caffeine metabolism, organism-specific biosystem; Caffeine metabolism, conserved biosystem; Drug metabolism - other enzymes, organism-specific biosystem;
Function acetyltransferase activity; arylamine N-acetyltransferase activity; transferase activity, transferring acyl groups;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NAT1 Products

Required fields are marked with *

My Review for All NAT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon