Recombinant Human NAT1, Fc-tagged
| Cat.No. : | NAT1-30283TH |
| Product Overview : | Recombinant fragment: DFESMNTYLQ TSPSSVFTSK SFCSLQTPDG VHCLVGFTLT HRRFNYKDNT DLIEFKTLSE EEIEKVLKNI FNISLQRKLV PKHGDRFFTI of Human NAT1 (amino acids 201-290) with N terminal proprietary tag, 35.53 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Fc |
| Protein Length : | 90 amino acids |
| Description : | This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Conjugation : | Fc |
| Molecular Weight : | 35.530kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | DFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI |
| Sequence Similarities : | Belongs to the arylamine N-acetyltransferase family. |
| Gene Name | NAT1 N-acetyltransferase 1 (arylamine N-acetyltransferase) [ Homo sapiens ] |
| Official Symbol | NAT1 |
| Synonyms | NAT1; N-acetyltransferase 1 (arylamine N-acetyltransferase); AAC1; arylamine N-acetyltransferase 1; |
| Gene ID | 9 |
| mRNA Refseq | NM_000662 |
| Protein Refseq | NP_000653 |
| MIM | 108345 |
| Uniprot ID | P18440 |
| Chromosome Location | 8p22 |
| Pathway | Acetylation, organism-specific biosystem; Biological oxidations, organism-specific biosystem; Caffeine metabolism, organism-specific biosystem; Caffeine metabolism, conserved biosystem; Drug metabolism - other enzymes, organism-specific biosystem; |
| Function | acetyltransferase activity; arylamine N-acetyltransferase activity; transferase activity, transferring acyl groups; |
| ◆ Recombinant Proteins | ||
| NAT1-5915M | Recombinant Mouse NAT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Nat1-3653M | Recombinant Mouse Nat1, His-tagged | +Inquiry |
| NAT1-328HF | Recombinant Full Length Human NAT1 Protein | +Inquiry |
| NAT1-3573H | Recombinant Human NAT1, His-tagged | +Inquiry |
| NAT1-30283TH | Recombinant Human NAT1, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NAT1-1168HCL | Recombinant Human NAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAT1 Products
Required fields are marked with *
My Review for All NAT1 Products
Required fields are marked with *
