Recombinant Full Length Human NCF2 Protein, C-Flag-tagged
Cat.No. : | NCF2-573HFL |
Product Overview : | Recombinant Full Length Human NCF2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes neutrophil cytosolic factor 2, the 67-kilodalton cytosolic subunit of the multi-protein NADPH oxidase complex found in neutrophils. This oxidase produces a burst of superoxide which is delivered to the lumen of the neutrophil phagosome. Mutations in this gene, as well as in other NADPH oxidase subunits, can result in chronic granulomatous disease, a disease that causes recurrent infections by catalase-positive organisms. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 59.6 kDa |
AA Sequence : | MSLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHL AVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKA EEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGRLFRPNERQVAQLAKKDYLGKATVVASVVD QDSFSGFAPLQPQAAEPPPRPKTPEIFRALEGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATV MFNGQKGLVPCNYLEPVELRIHPQQQPQEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPKEVKLSVPM PYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEQTKLSYRPRDSNELVPLSEDSMKDAWGQVKNY CLTLWCENTVGDQGFPDEPKESEKADANNQTTEPQLKKGSQVEALFSYEATQPEDLEFQEGDIILVLSKV NEEWLEGECKGKVGIFPKVFVEDCATTDLESTRREVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Leukocyte transendothelial migration |
Full Length : | Full L. |
Gene Name | NCF2 neutrophil cytosolic factor 2 [ Homo sapiens (human) ] |
Official Symbol | NCF2 |
Synonyms | NCF-2; NOXA2; P67PHOX; P67-PHOX |
Gene ID | 4688 |
mRNA Refseq | NM_001127651.3 |
Protein Refseq | NP_001121123.1 |
MIM | 608515 |
UniProt ID | P19878 |
◆ Recombinant Proteins | ||
NCF2-5891H | Recombinant Human NCF2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NCF2-4544H | Recombinant Human NCF2 protein, GST-tagged | +Inquiry |
NCF2-5938M | Recombinant Mouse NCF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NCF2-475H | Recombinant Human NCF2 Protein, MYC/DDK-tagged | +Inquiry |
NCF2-1856H | Recombinant Human NCF2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCF2-001HCL | Recombinant Human NCF2 cell lysate | +Inquiry |
NCF2-005HCL | Recombinant Human NCF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NCF2 Products
Required fields are marked with *
My Review for All NCF2 Products
Required fields are marked with *
0
Inquiry Basket