Recombinant Full Length Human NDRG4 Protein, C-Flag-tagged
Cat.No. : | NDRG4-914HFL |
Product Overview : | Recombinant Full Length Human NDRG4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that is required for cell cycle progression and survival in primary astrocytes and may be involved in the regulation of mitogenic signalling in vascular smooth muscles cells. Alternative splicing results in multiple transcripts encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 40.5 kDa |
AA Sequence : | MAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWKEHDIETPYGLLHVVIRGSPKGNRPAILTYHD VGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYV IGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNN TELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNS KLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYMPSASMTRLARSRTASLTSASSVDGSRPQA CTHSESSEGLGQVNHTMEVSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NDRG4 NDRG family member 4 [ Homo sapiens (human) ] |
Official Symbol | NDRG4 |
Synonyms | BDM1; SMAP8; SMAP-8 |
Gene ID | 65009 |
mRNA Refseq | NM_022910.4 |
Protein Refseq | NP_075061.1 |
MIM | 614463 |
UniProt ID | Q9ULP0 |
◆ Recombinant Proteins | ||
NDRG4-2428H | Recombinant Human NDRG4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NDRG4-10506M | Recombinant Mouse NDRG4 Protein | +Inquiry |
NDRG4-5959M | Recombinant Mouse NDRG4 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDRG4-4201Z | Recombinant Zebrafish NDRG4 | +Inquiry |
NDRG4-520H | Recombinant Human NDRG4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDRG4-3928HCL | Recombinant Human NDRG4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDRG4 Products
Required fields are marked with *
My Review for All NDRG4 Products
Required fields are marked with *
0
Inquiry Basket