Recombinant Full Length Human Neuropeptide Ff Receptor 2(Npffr2) Protein, His-Tagged
Cat.No. : | RFL1175HF |
Product Overview : | Recombinant Full Length Human Neuropeptide FF receptor 2(NPFFR2) Protein (Q9Y5X5) (1-522aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-522) |
Form : | Lyophilized powder |
AA Sequence : | MNSFFGTPAASWCLLESDVSSAPDKEAGRERRALSVQQRGGPAWSGSLEWSRQSAGDRRR LGLSRQTAKSSWSRSRDRTCCCRRAWWILVPAADRARRERFIMNEKWDTNSSENWHPIWN VNDTKHHLYSDINITYVNYYLHQPQVAAIFIISYFLIFFLCMMGNTVVCFIVMRNKHMHT VTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVA IAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQN KTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKN QEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFA HWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQ LVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETTNSSEI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NPFFR2 |
Synonyms | NPFFR2; GPR74; NPFF2; NPGPR; Neuropeptide FF receptor 2; G-protein coupled receptor 74; G-protein coupled receptor HLWAR77; Neuropeptide G-protein coupled receptor |
UniProt ID | Q9Y5X5 |
◆ Recombinant Proteins | ||
NPFFR2-6025H | Recombinant Human NPFFR2 Protein | +Inquiry |
NPFFR2-10818M | Recombinant Mouse NPFFR2 Protein | +Inquiry |
RFL23439RF | Recombinant Full Length Rat Neuropeptide Ff Receptor 2(Npffr2) Protein, His-Tagged | +Inquiry |
NPFFR2-1341H | Recombinant Human NPFFR2, His-tagged | +Inquiry |
RFL20677MF | Recombinant Full Length Mouse Neuropeptide Ff Receptor 2(Npffr2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPFFR2-1209HCL | Recombinant Human NPFFR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPFFR2 Products
Required fields are marked with *
My Review for All NPFFR2 Products
Required fields are marked with *
0
Inquiry Basket