Recombinant Full Length Human NKX2-3 Protein, GST-tagged

Cat.No. : NKX2-3-6678HF
Product Overview : Human NKX2-3 full-length ORF ( NP_660328.1, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 293 amino acids
Description : NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions. See Harvey (1996) [PubMed 8812123] for a review of the structure, regulation, function, and evolution of NK2 homeobox genes with an emphasis on their roles in heart development.[supplied by OMIM
Molecular Mass : 58.9 kDa
AA Sequence : MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLASSLKLTSTQVKIWFQNRRYKCKRQRQDKSLELGAHAPPPPPRRVAVPVLVRDGKPCVTPSAQAYGAPYSVGASAYSYNSFPAYGYGNSAAGPPRRPLPCSPPAARPEAAPL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NKX2-3 NK2 homeobox 3 [ Homo sapiens ]
Official Symbol NKX2-3
Synonyms NKX2-3; NK2 homeobox 3; NK 2 (Drosophila) homolog C , NK2 transcription factor related, locus 3 (Drosophila) , NKX2C; homeobox protein Nkx-2.3; CSX3; NKX2.3; NKX4 3; homeobox protein NK-2 homolog C; NK2 transcription factor related, locus 3; NK2.3; NKX2C; NKX4-3;
Gene ID 159296
mRNA Refseq NM_145285
Protein Refseq NP_660328
MIM 606727
UniProt ID Q8TAU0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NKX2-3 Products

Required fields are marked with *

My Review for All NKX2-3 Products

Required fields are marked with *

0
cart-icon
0
compare icon