Recombinant Full Length Human NKX2-5 Protein, C-Flag-tagged
Cat.No. : | NKX2-5-1742HFL |
Product Overview : | Recombinant Full Length Human NKX2-5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Protein Length : | 1-324 a.a. |
Description : | This gene encodes a homeobox-containing transcription factor. This transcription factor functions in heart formation and development. Mutations in this gene cause atrial septal defect with atrioventricular conduction defect, and also tetralogy of Fallot, which are both heart malformation diseases. Mutations in this gene can also cause congenital hypothyroidism non-goitrous type 5, a non-autoimmune condition. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 34.7 kDa |
AA Sequence : | MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELR AELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRK PRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPP PPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSP AQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | NKX2-5 NK2 homeobox 5 [ Homo sapiens (human) ] |
Official Symbol | NKX2-5 |
Synonyms | CSX; CSX1; VSD3; CHNG5; HLHS2; NKX2E; NKX2.5; NKX4-1 |
Gene ID | 1482 |
mRNA Refseq | NM_004387.4 |
Protein Refseq | NP_004378.1 |
MIM | 600584 |
UniProt ID | P52952 |
◆ Recombinant Proteins | ||
NKX2-5-3993R | Recombinant Rat NKX2-5 Protein | +Inquiry |
NKX2-5-5900H | Recombinant Human NKX2-5 Protein, GST-tagged | +Inquiry |
NKX2-5-340H | Recombinant Human NKX2-5 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Nkx2-5-4424M | Recombinant Mouse Nkx2-5 Protein, Myc/DDK-tagged | +Inquiry |
NKX2-5-10700M | Recombinant Mouse NKX2-5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NKX2-5-439HCL | Recombinant Human NKX2-5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKX2-5 Products
Required fields are marked with *
My Review for All NKX2-5 Products
Required fields are marked with *
0
Inquiry Basket