Recombinant Full Length Human NKX2-5 Protein, GST-tagged

Cat.No. : NKX2-5-6703HF
Product Overview : Human NKX2-5 full-length ORF ( AAH25711, 1 a.a. - 324 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 324 amino acids
Description : Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development (Shiojima et al., 1995 [PubMed 7665173]). It has been demonstrated that a Drosophila homeobox-containing gene called tinman is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.[supplied by OMIM
Molecular Mass : 61.38 kDa
AA Sequence : MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NKX2-5 NK2 homeobox 5 [ Homo sapiens ]
Official Symbol NKX2-5
Synonyms NKX2-5; NK2 homeobox 5; cardiac specific homeo box , CSX, NK2 transcription factor related, locus 5 (Drosophila) , NKX2E; homeobox protein Nkx-2.5; CSX1; NKX2.5; NKX4 1; tinman paralog (Drosophila); tinman paralog; homeobox protein CSX; cardiac-specific homeobox 1; homeobox protein NK-2 homolog E; NK2 transcription factor related, locus 5; CSX; VSD3; CHNG5; HLHS2; NKX2E; NKX4-1; FLJ52202; FLJ97166; FLJ97195; FLJ97197; FLJ99536;
Gene ID 1482
mRNA Refseq NM_001166175
Protein Refseq NP_001159647
MIM 600584
UniProt ID P52952

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NKX2-5 Products

Required fields are marked with *

My Review for All NKX2-5 Products

Required fields are marked with *

0
cart-icon
0
compare icon